PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.009G036500.5.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 431aa    MW: 47572.1 Da    PI: 6.7292
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.009G036500.5.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding551.8e-171461148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g W++eEde+l + ++++G g+W+++++  g+ R++k+c++rw +yl
  Sobic.009G036500.5.p 14 KGLWSPEEDEKLMNHITKHGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                          678*******************************************97 PP

2Myb_DNA-binding476e-1567110146
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           rg+++++E+el++++++ lG++ W+ Ia+ ++ gRt++++k+ w++
  Sobic.009G036500.5.p  67 RGAFSQDEEELIIELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                           89********************.*********.*********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-27664IPR009057Homeodomain-like
PROSITE profilePS5129418.6961IPR017930Myb domain
SuperFamilySSF466892.85E-2912108IPR009057Homeodomain-like
SMARTSM007175.0E-121363IPR001005SANT/Myb domain
PfamPF002493.4E-151461IPR001005SANT/Myb domain
CDDcd001673.40E-111761No hitNo description
PROSITE profilePS5129425.49662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.8E-2565116IPR009057Homeodomain-like
SMARTSM007179.8E-1366114IPR001005SANT/Myb domain
PfamPF002491.7E-1367110IPR001005SANT/Myb domain
CDDcd001679.98E-1069109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0009733Biological Processresponse to auxin
GO:0010089Biological Processxylem development
GO:0010119Biological Processregulation of stomatal movement
GO:0010214Biological Processseed coat development
GO:0048364Biological Processroot development
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 431 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLMNHIT KHGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SQDEEELIIE LHAVLGNRWS QIAAQLPGRT DNEIKNLWNS CIKKKLRQKG  120
IDPNTHKPLT EADRSGAAPT VSTERTSGSS DVNPSSAGAL GNLSHLLSET AQSSMLMPMY  180
DKNRTETPNL ARPKVPPKEL FLEQLTAGHE SPSTCRSSGQ TLYFPFQQPL GYNSESGSGD  240
GANMNSLWFN QSDFNCSTIS TVMPPVSPSA LSTSMGLNLP PDNPRHGGTG IGSTAVDSFY  300
WDGTNPSSSS STGSRGSNSM GFEPQSTSSI LENSVFPWTN IGQEKDTRAH LVEELKWPDL  360
LHGTFAETTT AMQNQSQTLY DDVIKAESQF SMEGICASWF QNQQTQQQLQ AAPNMYDKDL  420
QRMQLSFENI *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28121165108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.126130.0panicle
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00134DAPTransfer from AT1G09540Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0357510.0BT035751.1 Zea mays full-length cDNA clone ZM_BFb0081N12 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001132070.10.0MYB transcription factor
TrEMBLB4FF630.0B4FF63_MAIZE; MYB transcription factor
STRINGGRMZM2G127490_P010.0(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.11e-89myb domain protein 61